PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10024394
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 509aa    MW: 56218.1 Da    PI: 9.3082
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10024394genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.3e-1859105148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEde l +av+ + g++Wk+Ia++++  R++ qc +rwqk+l
      Lus10024394  59 KGGWTPEEDETLRKAVAAYKGKSWKKIAEYFP-DRSEVQCLHRWQKVL 105
                      688*****************************.************986 PP

2Myb_DNA-binding63.83.4e-20111157148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+++v++v+++G+  W+ Ia+ ++ gR +kqc++rw+++l
      Lus10024394 111 KGPWTPEEDDKIVKLVTKYGPTKWSVIAKSLP-GRIGKQCRERWHNHL 157
                      79******************************.*************97 PP

3Myb_DNA-binding61.22.2e-19163206146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT eE++ lv+a++++G++ W+ Ia++++ gRt++++k++w++
      Lus10024394 163 KDAWTLEEELALVNAHRMHGNK-WAEIAKMLP-GRTDNSIKNHWNS 206
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.35154105IPR017930Myb domain
SuperFamilySSF466897.18E-1655112IPR009057Homeodomain-like
SMARTSM007176.1E-1658107IPR001005SANT/Myb domain
PfamPF002499.9E-1759105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-2361117IPR009057Homeodomain-like
CDDcd001671.50E-1362105No hitNo description
PROSITE profilePS5129432.407106161IPR017930Myb domain
SuperFamilySSF466895.62E-32108204IPR009057Homeodomain-like
SMARTSM007177.1E-18110159IPR001005SANT/Myb domain
PfamPF002491.5E-18111157IPR001005SANT/Myb domain
CDDcd001671.52E-15113157No hitNo description
Gene3DG3DSA:1.10.10.606.9E-28118164IPR009057Homeodomain-like
SMARTSM007175.9E-18162210IPR001005SANT/Myb domain
PROSITE profilePS5129423.217162212IPR017930Myb domain
PfamPF002491.6E-17163206IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-24165212IPR009057Homeodomain-like
CDDcd001673.49E-13165208No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MDEAKVEECC RENKQQTAAS SSSVSEGCGS AVLKSPGVSS PITASPIHRR TTGPIRRAKG  60
GWTPEEDETL RKAVAAYKGK SWKKIAEYFP DRSEVQCLHR WQKVLNPDLV KGPWTPEEDD  120
KIVKLVTKYG PTKWSVIAKS LPGRIGKQCR ERWHNHLNPD IKKDAWTLEE ELALVNAHRM  180
HGNKWAEIAK MLPGRTDNSI KNHWNSSLKK KLDFYMVTGK LPSVQRNGVQ KGSAEVNRHG  240
LTRTTKESDS TAQTSSDTTV ICRLEDGNSK DQLESSVHLP RLVADSECRI PTCLDDSSCD  300
NIELRQNFEA CGLNGEVNKG LSIGSPPVAA TPSRGYLWYE PPSEPDRCLR QEYGSSPVSS  360
SPVGFFTPQS ASSSSSLSVQ SPETRLRIAA QTYPNTPSIF RKRKTVDRAS IPSSSSKLDK  420
EEGISISQSN QKPTLHSSPS LVDIGSSNLK SFNASPPYRL RPKRTPVLKS VERQLEFSFE  480
EDPRHDGESK AVRYSTEGSS LAPKMAVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-71582125159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-71582125159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002532327.10.0PREDICTED: uncharacterized protein LOC8268281 isoform X2
TrEMBLB9T2580.0B9T258_RICCO; Myb3r3, putative
STRINGPOPTR_0006s08570.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66163449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-134myb domain protein 3r-5